Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) automatically mapped to Pfam PF01324 |
Family b.2.1.0: automated matches [254321] (1 protein) not a true family |
Protein automated matches [254735] (1 species) not a true protein |
Species Corynebacterium diphtheriae [TaxId:1717] [256178] (7 PDB entries) |
Domain d7k7ca3: 7k7c A:381-535 [394817] Other proteins in same PDB: d7k7ca1, d7k7ca2, d7k7ca4, d7k7cb1, d7k7cb2, d7k7cb4 automated match to d1f0la1 |
PDB Entry: 7k7c (more details), 2.05 Å
SCOPe Domain Sequences for d7k7ca3:
Sequence, based on SEQRES records: (download)
>d7k7ca3 b.2.1.0 (A:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih sneissdsigvlgyqktvdhtkvnsklslffeiks
>d7k7ca3 b.2.1.0 (A:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih sneissdsigvlgyqkkvnsklslffeiks
Timeline for d7k7ca3:
View in 3D Domains from other chains: (mouse over for more information) d7k7cb1, d7k7cb2, d7k7cb3, d7k7cb4 |