Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (13 species) not a true protein |
Species Corynebacterium diphtheriae [TaxId:1717] [256176] (7 PDB entries) |
Domain d7k7ca1: 7k7c A:5-187 [394815] Other proteins in same PDB: d7k7ca2, d7k7ca3, d7k7ca4, d7k7cb2, d7k7cb3, d7k7cb4 automated match to d1f0la2 |
PDB Entry: 7k7c (more details), 2.05 Å
SCOPe Domain Sequences for d7k7ca1:
Sequence, based on SEQRES records: (download)
>d7k7ca1 d.166.1.0 (A:5-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} vvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwegfystdnkydaag ysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteefi krfgdgasrvvlslpfaegsssvkyinnweqakalsveleinfetrgkrgqdamyeymaq aca
>d7k7ca1 d.166.1.0 (A:5-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} vvdssksfvmenfssyhgtkpgyvdsiqkgiqkpddwegfystdnkydaagysvdnenpl sgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteefikrfgdgasr vvlslpfaegsssvkyinnweqakalsveleinfetrgkrgqdamyeymaqaca
Timeline for d7k7ca1:
View in 3D Domains from other chains: (mouse over for more information) d7k7cb1, d7k7cb2, d7k7cb3, d7k7cb4 |