SCOPe 2.01: Domain d1diqb1: 1diq B:243-521

Lineage for d1diqb1 (1diq B:243-521)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (4 families)
   duplication: contains two subdomains of this fold

5. Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins)

6. Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species)
   the other subunit is a short-chain cytochrome c

7. Species Pseudomonas putida [TaxId:303] [55108] (4 PDB entries)

8. Domain d1diqb1: 1diq B:243-521 [39480]
   Other proteins in same PDB: d1diqa2, d1diqb2, d1diqc_, d1diqd_
   complexed with cl, fad, hem, pcr

Details for d1diqb1

PDB Entry: 1diq, 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound

PDB Compounds: (B:) p-cresol methylhydroxylase

SCOPe Domain Sequences for d1diqb1:

Sequence; same for both SEQRES and ATOM records:

>d1diqb1 d.58.32.1 (B:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

Timeline for d1diqb1:

• d1diqb1 first appeared (with stable ids) in SCOP 1.55
  
• d1diqb1 appears in SCOP 1.75
  
• d1diqb1 appears in SCOPe 2.02
  
• d1diqb1 appears in the current release, SCOPe 2.08