Lineage for d7k7da3 (7k7d A:381-535)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767183Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) (S)
    automatically mapped to Pfam PF01324
  5. 2767198Family b.2.1.0: automated matches [254321] (1 protein)
    not a true family
  6. 2767199Protein automated matches [254735] (1 species)
    not a true protein
  7. 2767200Species Corynebacterium diphtheriae [TaxId:1717] [256178] (7 PDB entries)
  8. 2767206Domain d7k7da3: 7k7d A:381-535 [394776]
    Other proteins in same PDB: d7k7da1, d7k7da2, d7k7da4, d7k7db1, d7k7db2, d7k7db4
    automated match to d1f0la1

Details for d7k7da3

PDB Entry: 7k7d (more details), 2.1 Å

PDB Description: crystal structure of diphtheria toxin from crystals obtained at ph 6.0
PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d7k7da3:

Sequence, based on SEQRES records: (download)

>d7k7da3 b.2.1.0 (A:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

Sequence, based on observed residues (ATOM records): (download)

>d7k7da3 b.2.1.0 (A:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqkkvnsklslffeiks

SCOPe Domain Coordinates for d7k7da3:

Click to download the PDB-style file with coordinates for d7k7da3.
(The format of our PDB-style files is described here.)

Timeline for d7k7da3: