SCOPe 2.08: Domain d7k7cb2: 7k7c B:200-380

Lineage for d7k7cb2 (7k7c B:200-380)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families)
   automatically mapped to Pfam PF02764

5. Family f.1.2.0: automated matches [254320] (1 protein)
   not a true family

6. Protein automated matches [254734] (1 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [256177] (7 PDB entries)

8. Domain d7k7cb2: 7k7c B:200-380 [394741]
   Other proteins in same PDB: d7k7ca1, d7k7ca3, d7k7ca4, d7k7cb1, d7k7cb3, d7k7cb4
   automated match to d1ddta3

Details for d7k7cb2

PDB Entry: 7k7c, 2.05 Å

PDB Description: crystal structure of diphtheria toxin from crystals obtained at ph 5.5

PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d7k7cb2:

Sequence, based on SEQRES records:

>d7k7cb2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

Sequence, based on observed residues (ATOM records):

>d7k7cb2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkepikkmsespnktvseekakqyleefhqtalehpelse
lktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadgavh
hnteeivaqsialsslmvaqaiplvgegfaaynfvesiinlfqvvhnsynrpay

Timeline for d7k7cb2:

• d7k7cb2 first appeared in SCOPe 2.07