Lineage for d7k7cb2 (7k7c B:200-380)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021051Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) (S)
    automatically mapped to Pfam PF02764
  5. 3021066Family f.1.2.0: automated matches [254320] (1 protein)
    not a true family
  6. 3021067Protein automated matches [254734] (1 species)
    not a true protein
  7. 3021068Species Corynebacterium diphtheriae [TaxId:1717] [256177] (7 PDB entries)
  8. 3021073Domain d7k7cb2: 7k7c B:200-380 [394741]
    Other proteins in same PDB: d7k7ca1, d7k7ca3, d7k7ca4, d7k7cb1, d7k7cb3, d7k7cb4
    automated match to d1ddta3

Details for d7k7cb2

PDB Entry: 7k7c (more details), 2.05 Å

PDB Description: crystal structure of diphtheria toxin from crystals obtained at ph 5.5
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d7k7cb2:

Sequence, based on SEQRES records: (download)

>d7k7cb2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

Sequence, based on observed residues (ATOM records): (download)

>d7k7cb2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkepikkmsespnktvseekakqyleefhqtalehpelse
lktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadgavh
hnteeivaqsialsslmvaqaiplvgegfaaynfvesiinlfqvvhnsynrpay

SCOPe Domain Coordinates for d7k7cb2:

Click to download the PDB-style file with coordinates for d7k7cb2.
(The format of our PDB-style files is described here.)

Timeline for d7k7cb2: