Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein automated matches [190066] (7 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries) |
Domain d7jsxp_: 7jsx P: [394595] Other proteins in same PDB: d7jsxa1, d7jsxa2, d7jsxc1, d7jsxc2, d7jsxe1, d7jsxe2, d7jsxg1, d7jsxg2, d7jsxi1, d7jsxi2, d7jsxk1, d7jsxk2, d7jsxm1, d7jsxm2, d7jsxo1, d7jsxo2 automated match to d1ir21_ |
PDB Entry: 7jsx (more details), 2.06 Å
SCOPe Domain Sequences for d7jsxp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jsxp_ d.73.1.1 (P:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg flvqrpksardwqpankr
Timeline for d7jsxp_: