Lineage for d7jn4e1 (7jn4 E:18-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952778Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2952779Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2952803Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (6 PDB entries)
  8. 2952834Domain d7jn4e1: 7jn4 E:18-149 [394549]
    Other proteins in same PDB: d7jn4a2, d7jn4b_, d7jn4c2, d7jn4d_, d7jn4e2, d7jn4f_, d7jn4g2, d7jn4h_, d7jn4i2, d7jn4j_, d7jn4k2, d7jn4l_, d7jn4m2, d7jn4n_, d7jn4o2, d7jn4p_
    automated match to d1gk8a2

Details for d7jn4e1

PDB Entry: 7jn4 (more details), 2.68 Å

PDB Description: rubisco in the apo state
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d7jn4e1:

Sequence, based on SEQRES records: (download)

>d7jn4e1 d.58.9.1 (E:18-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvwtdgltsl
drykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkalralrled
lrippayvktfv

Sequence, based on observed residues (ATOM records): (download)

>d7jn4e1 d.58.9.1 (E:18-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaedrykgrcydiepvpged
nqyiayvaypidlfeegsvtnmftsivgnvfgfkalralrledlrippayvktfv

SCOPe Domain Coordinates for d7jn4e1:

Click to download the PDB-style file with coordinates for d7jn4e1.
(The format of our PDB-style files is described here.)

Timeline for d7jn4e1: