Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
Protein Receptor-type monomeric adenylyl cyclase [55081] (1 species) |
Species Trypanosome (Trypanosoma brucei), different isoform [TaxId:5691] [55082] (2 PDB entries) |
Domain d1fx4a_: 1fx4 A: [39431] variant Gresag 4.3 complexed with mg |
PDB Entry: 1fx4 (more details), 1.9 Å
SCOPe Domain Sequences for d1fx4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx4a_ d.58.29.1 (A:) Receptor-type monomeric adenylyl cyclase {Trypanosome (Trypanosoma brucei), different isoform [TaxId: 5691]} dndsapkeptgpvtliftdiesstalwaahpdlmpdavathhrlirslitryecyevktv gdsfmiaskspfaavqlaqelqlcflrldwetnavdesyrefeeqraegeceytpptasl dpevysrlwnglrvrvgihtglcdirydevtkgydyygrtsnmaartesvanggqvlmth aaymslsgedrnqldvttlgatvlrgvpepvrmyqlnavpgrnfaalrldr
Timeline for d1fx4a_: