Lineage for d1cjvb_ (1cjv B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197663Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197664Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2197683Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)
  7. 2197684Species Norway rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)
  8. 2197691Domain d1cjvb_: 1cjv B: [39429]
    Other proteins in same PDB: d1cjva_, d1cjvc1, d1cjvc2
    complexed with cl, dad, fok, gsp, mes, mg, zn

Details for d1cjvb_

PDB Entry: 1cjv (more details), 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn
PDB Compounds: (B:) adenylate cyclase, type II

SCOPe Domain Sequences for d1cjvb_:

Sequence, based on SEQRES records: (download)

>d1cjvb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d1cjvb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpviagv
igaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkgd
lktyfvnt

SCOPe Domain Coordinates for d1cjvb_:

Click to download the PDB-style file with coordinates for d1cjvb_.
(The format of our PDB-style files is described here.)

Timeline for d1cjvb_: