Lineage for d1cjvb_ (1cjv B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 33051Superfamily d.58.29: Adenylyl and guanylyl cyclase catalytic domain [55073] (1 family) (S)
  5. 33052Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (4 proteins)
  6. 33053Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)
  7. 33054Species Rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)
  8. 33061Domain d1cjvb_: 1cjv B: [39429]
    Other proteins in same PDB: d1cjva_, d1cjvc1, d1cjvc2

Details for d1cjvb_

PDB Entry: 1cjv (more details), 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn

SCOP Domain Sequences for d1cjvb_:

Sequence, based on SEQRES records: (download)

>d1cjvb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus)}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d1cjvb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus)}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpviagv
igaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkgd
lktyfvnt

SCOP Domain Coordinates for d1cjvb_:

Click to download the PDB-style file with coordinates for d1cjvb_.
(The format of our PDB-style files is described here.)

Timeline for d1cjvb_: