Lineage for d1cjkb_ (1cjk B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 33051Superfamily d.58.29: Adenylyl and guanylyl cyclase catalytic domain [55073] (1 family) (S)
  5. 33052Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (4 proteins)
  6. 33053Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)
  7. 33054Species Rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)
  8. 33060Domain d1cjkb_: 1cjk B: [39428]
    Other proteins in same PDB: d1cjka_, d1cjkc1, d1cjkc2

Details for d1cjkb_

PDB Entry: 1cjk (more details), 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5'-(alpha thio)-triphosphate (rp), mg, and mn

SCOP Domain Sequences for d1cjkb_:

Sequence, based on SEQRES records: (download)

>d1cjkb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus)}
lyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvek
iktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfkl
rvginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytc
tcrgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d1cjkb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus)}
lyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvek
iktigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpvia
gvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgk
gdlktyfvnt

SCOP Domain Coordinates for d1cjkb_:

Click to download the PDB-style file with coordinates for d1cjkb_.
(The format of our PDB-style files is described here.)

Timeline for d1cjkb_: