Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [268023] (2 PDB entries) |
Domain d7a4ma_: 7a4m A: [394274] automated match to d3wnwa_ complexed with fe, zn |
PDB Entry: 7a4m (more details), 1.22 Å
SCOPe Domain Sequences for d7a4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a4ma_ a.25.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} psqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheere haeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatdk ndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
Timeline for d7a4ma_: