Lineage for d1cjub_ (1cju B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 134112Superfamily d.58.29: Adenylyl and guanylyl cyclase catalytic domain [55073] (1 family) (S)
  5. 134113Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (4 proteins)
  6. 134114Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)
  7. 134115Species Rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)
  8. 134120Domain d1cjub_: 1cju B: [39427]
    Other proteins in same PDB: d1cjua_, d1cjuc1, d1cjuc2

Details for d1cjub_

PDB Entry: 1cju (more details), 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp and mg

SCOP Domain Sequences for d1cjub_:

Sequence, based on SEQRES records: (download)

>d1cjub_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus)}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklr
vginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytct
crgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d1cjub_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus)}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
dlktyfvnt

SCOP Domain Coordinates for d1cjub_:

Click to download the PDB-style file with coordinates for d1cjub_.
(The format of our PDB-style files is described here.)

Timeline for d1cjub_: