Lineage for d1azsb_ (1azs B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2521614Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2521615Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2521634Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)
  7. 2521635Species Norway rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)
  8. 2521636Domain d1azsb_: 1azs B: [39423]
    Other proteins in same PDB: d1azsa_, d1azsc1, d1azsc2
    complexed with fkp, gsp, mg

Details for d1azsb_

PDB Entry: 1azs (more details), 2.3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase
PDB Compounds: (B:) iic2

SCOPe Domain Sequences for d1azsb_:

Sequence, based on SEQRES records: (download)

>d1azsb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d1azsb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
dlktyfvnt

SCOPe Domain Coordinates for d1azsb_:

Click to download the PDB-style file with coordinates for d1azsb_.
(The format of our PDB-style files is described here.)

Timeline for d1azsb_: