Lineage for d1cjua_ (1cju A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 33051Superfamily d.58.29: Adenylyl and guanylyl cyclase catalytic domain [55073] (1 family) (S)
  5. 33052Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (4 proteins)
  6. 33062Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)
  7. 33063Species Dog (Canis familiaris) [TaxId:9615] [55078] (7 PDB entries)
  8. 33068Domain d1cjua_: 1cju A: [39420]
    Other proteins in same PDB: d1cjub_, d1cjuc1, d1cjuc2

Details for d1cjua_

PDB Entry: 1cju (more details), 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp and mg

SCOP Domain Sequences for d1cjua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjua_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris)}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

SCOP Domain Coordinates for d1cjua_:

Click to download the PDB-style file with coordinates for d1cjua_.
(The format of our PDB-style files is described here.)

Timeline for d1cjua_: