SCOPe 2.07: Domain d6ymxo2: 6ymx O:261-309

Lineage for d6ymxo2 (6ymx O:261-309)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.0: automated matches [232790] (1 protein)
   not a true family

6. Protein automated matches [232791] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257473] (2 PDB entries)

8. Domain d6ymxo2: 6ymx O:261-309 [393833]
   Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd1, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_
   automated match to d2ibzd2
   complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxo2

PDB Entry: 6ymx, 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae

PDB Compounds: (O:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d6ymxo2:

Sequence; same for both SEQRES and ATOM records:

>d6ymxo2 f.23.11.0 (O:261-309) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkprk

Timeline for d6ymxo2:

• d6ymxo2 is new in SCOPe 2.07-stable
  
• d6ymxo2 appears in the current release, SCOPe 2.08