Lineage for d6ymxd1 (6ymx D:62-260)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304893Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 2304937Protein automated matches [232767] (3 species)
    not a true protein
  7. 2304938Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257471] (2 PDB entries)
  8. 2304939Domain d6ymxd1: 6ymx D:62-260 [393692]
    Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_
    automated match to d3cx5d1
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxd1

PDB Entry: 6ymx (more details), 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d6ymxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ymxd1 a.3.1.3 (D:62-260) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
attsqmakdvttflnwcae

SCOPe Domain Coordinates for d6ymxd1:

Click to download the PDB-style file with coordinates for d6ymxd1.
(The format of our PDB-style files is described here.)

Timeline for d6ymxd1: