Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein automated matches [190231] (14 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [393615] (2 PDB entries) |
Domain d6yezn_: 6yez N: [393674] Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezl_, d6yezp_ automated match to d1gaqb_ complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yez (more details), 2.7 Å
SCOPe Domain Sequences for d6yezn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yezn_ d.15.4.1 (N:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} asykvklvtpdgtqefecpsdvyildhaeevgidlpyscragscsscagkvvggevdqsd gsflddeqieagfvltcvayptsdvviethkeedlta
Timeline for d6yezn_: