SCOPe 2.08: Domain d6yezn_: 6yez N:

Lineage for d6yezn_ (6yez N:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein automated matches [190231] (14 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [393615] (2 PDB entries)

8. Domain d6yezn_: 6yez N: [393674]
   Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezl_, d6yezp_
   automated match to d1gaqb_
   complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yezn_

PDB Entry: 6yez, 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex

PDB Compounds: (N:) Ferredoxin-1, chloroplastic

SCOPe Domain Sequences for d6yezn_:

Sequence; same for both SEQRES and ATOM records:

>d6yezn_ d.15.4.1 (N:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
asykvklvtpdgtqefecpsdvyildhaeevgidlpyscragscsscagkvvggevdqsd
gsflddeqieagfvltcvayptsdvviethkeedlta

Timeline for d6yezn_:

• d6yezn_ first appeared in SCOPe 2.07