![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) ![]() |
![]() | Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins) |
![]() | Protein Carboxypeptidase G2 [55033] (1 species) dimerisation mode is similar to that of 1PSD domain |
![]() | Species Pseudomonas sp., strain rs-16 [TaxId:306] [55034] (1 PDB entry) |
![]() | Domain d1cg2c2: 1cg2 C:214-326 [39362] Other proteins in same PDB: d1cg2a1, d1cg2b1, d1cg2c1, d1cg2d1 complexed with zn |
PDB Entry: 1cg2 (more details), 2.5 Å
SCOPe Domain Sequences for d1cg2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cg2c2 d.58.19.1 (C:214-326) Carboxypeptidase G2 {Pseudomonas sp., strain rs-16 [TaxId: 306]} sgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlrfnwtiakagnv sniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtrgrpa
Timeline for d1cg2c2: