SCOPe 2.07: Domain d1cg2c2: 1cg2 C:214-326

Lineage for d1cg2c2 (1cg2 C:214-326)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family)
Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)
Protein Carboxypeptidase G2 [55033] (1 species)
dimerisation mode is similar to that of 1PSD domain
Species Pseudomonas sp., strain rs-16 [TaxId:306] [55034] (1 PDB entry)
Domain d1cg2c2: 1cg2 C:214-326 [39362]
Other proteins in same PDB: d1cg2a1, d1cg2b1, d1cg2c1, d1cg2d1
complexed with zn

Details for d1cg2c2

PDB Entry: 1cg2 (more details), 2.5 Å

PDB Description: carboxypeptidase g2

PDB Compounds: (C:) carboxypeptidase g2

SCOPe Domain Sequences for d1cg2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg2c2 d.58.19.1 (C:214-326) Carboxypeptidase G2 {Pseudomonas sp., strain rs-16 [TaxId: 306]}
sgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlrfnwtiakagnv
sniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtrgrpa

SCOPe Domain Coordinates for d1cg2c2:

Click to download the PDB-style file with coordinates for d1cg2c2.
(The format of our PDB-style files is described here.)

Timeline for d1cg2c2: