Lineage for d1cg2c2 (1cg2 C:214-326)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32955Superfamily d.58.19: Carboxypeptidase G2, dimerisation domain [55031] (1 family) (S)
  5. 32956Family d.58.19.1: Carboxypeptidase G2, dimerisation domain [55032] (1 protein)
  6. 32957Protein Carboxypeptidase G2, dimerisation domain [55033] (1 species)
  7. 32958Species Pseudomonas sp., strain rs-16 [TaxId:306] [55034] (1 PDB entry)
  8. 32961Domain d1cg2c2: 1cg2 C:214-326 [39362]
    Other proteins in same PDB: d1cg2a1, d1cg2b1, d1cg2c1, d1cg2d1

Details for d1cg2c2

PDB Entry: 1cg2 (more details), 2.5 Å

PDB Description: carboxypeptidase g2

SCOP Domain Sequences for d1cg2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg2c2 d.58.19.1 (C:214-326) Carboxypeptidase G2, dimerisation domain {Pseudomonas sp., strain rs-16}
sgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlrfnwtiakagnv
sniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtrgrpa

SCOP Domain Coordinates for d1cg2c2:

Click to download the PDB-style file with coordinates for d1cg2c2.
(The format of our PDB-style files is described here.)

Timeline for d1cg2c2: