SCOPe 2.08: Domain d1cg2b2: 1cg2 B:214-326

Lineage for d1cg2b2 (1cg2 B:214-326)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family)

5. Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)

6. Protein Carboxypeptidase G2 [55033] (1 species)
   dimerisation mode is similar to that of 1PSD domain

7. Species Pseudomonas sp., strain rs-16 [TaxId:306] [55034] (1 PDB entry)

8. Domain d1cg2b2: 1cg2 B:214-326 [39361]
   Other proteins in same PDB: d1cg2a1, d1cg2b1, d1cg2c1, d1cg2d1
   complexed with zn

Details for d1cg2b2

PDB Entry: 1cg2, 2.5 Å

PDB Description: carboxypeptidase g2

PDB Compounds: (B:) carboxypeptidase g2

SCOPe Domain Sequences for d1cg2b2:

Sequence; same for both SEQRES and ATOM records:

>d1cg2b2 d.58.19.1 (B:214-326) Carboxypeptidase G2 {Pseudomonas sp., strain rs-16 [TaxId: 306]}
sgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlrfnwtiakagnv
sniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtrgrpa

Timeline for d1cg2b2:

• d1cg2b2 first appeared (with stable ids) in SCOP 1.55
  
• d1cg2b2 appears in SCOPe 2.07