Lineage for d1cg2b2 (1cg2 B:214-326)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954343Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 2954344Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)
  6. 2954354Protein Carboxypeptidase G2 [55033] (1 species)
    dimerisation mode is similar to that of 1PSD domain
  7. 2954355Species Pseudomonas sp., strain rs-16 [TaxId:306] [55034] (1 PDB entry)
  8. 2954357Domain d1cg2b2: 1cg2 B:214-326 [39361]
    Other proteins in same PDB: d1cg2a1, d1cg2b1, d1cg2c1, d1cg2d1
    complexed with zn

Details for d1cg2b2

PDB Entry: 1cg2 (more details), 2.5 Å

PDB Description: carboxypeptidase g2
PDB Compounds: (B:) carboxypeptidase g2

SCOPe Domain Sequences for d1cg2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg2b2 d.58.19.1 (B:214-326) Carboxypeptidase G2 {Pseudomonas sp., strain rs-16 [TaxId: 306]}
sgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlrfnwtiakagnv
sniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtrgrpa

SCOPe Domain Coordinates for d1cg2b2:

Click to download the PDB-style file with coordinates for d1cg2b2.
(The format of our PDB-style files is described here.)

Timeline for d1cg2b2: