Lineage for d1cg2a2 (1cg2 A:214-326)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329588Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 329589Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (3 proteins)
  6. 329593Protein Carboxypeptidase G2 [55033] (1 species)
    dimerisation mode is similar to that of 1PSD domain
  7. 329594Species Pseudomonas sp., strain rs-16 [TaxId:306] [55034] (1 PDB entry)
  8. 329595Domain d1cg2a2: 1cg2 A:214-326 [39360]
    Other proteins in same PDB: d1cg2a1, d1cg2b1, d1cg2c1, d1cg2d1

Details for d1cg2a2

PDB Entry: 1cg2 (more details), 2.5 Å

PDB Description: carboxypeptidase g2

SCOP Domain Sequences for d1cg2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg2a2 d.58.19.1 (A:214-326) Carboxypeptidase G2 {Pseudomonas sp., strain rs-16}
sgiayvqvnitgkashagaapelgvnalveasdlvlrtmniddkaknlrfnwtiakagnv
sniipasatlnadvryarnedfdaamktleeraqqkklpeadvkvivtrgrpa

SCOP Domain Coordinates for d1cg2a2:

Click to download the PDB-style file with coordinates for d1cg2a2.
(The format of our PDB-style files is described here.)

Timeline for d1cg2a2: