SCOP 1.67: Domain d1psdb3: 1psd B:327-410

Lineage for d1psdb3 (1psd B:327-410)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (4 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)

6. Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (1 species)

7. Species Escherichia coli [TaxId:562] [55024] (1 PDB entry)

8. Domain d1psdb3: 1psd B:327-410 [39355]
   Other proteins in same PDB: d1psda1, d1psda2, d1psdb1, d1psdb2
   complexed with nad

Details for d1psdb3

PDB Entry: 1psd, 2.75 Å

PDB Description: the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase

SCOP Domain Sequences for d1psdb3:

Sequence; same for both SEQRES and ATOM records:

>d1psdb3 d.58.18.1 (B:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli}
fpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
edvaekalqamkaipgtirarlly

Timeline for d1psdb3:

• d1psdb3 first appeared (with stable ids) in SCOP 1.55
  
• d1psdb3 appears in SCOP 1.65
  
• d1psdb3 appears in SCOP 1.69
  
• d1psdb3 appears in the current release, SCOPe 2.08