Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d6xqpd1: 6xqp D:2-100 [393450] Other proteins in same PDB: d6xqpa1, d6xqpb2, d6xqpc1, d6xqpc2, d6xqpd2, d6xqpe1, d6xqpe2, d6xqpf1, d6xqpf2, d6xqpg1, d6xqpg2, d6xqph1, d6xqph2 automated match to d1duzb_ complexed with 2lj, br, cl, gol, na |
PDB Entry: 6xqp (more details), 2.9 Å
SCOPe Domain Sequences for d6xqpd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xqpd1 b.1.1.2 (D:2-100) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d6xqpd1: