SCOPe 2.08: Domain d6xqph2: 6xqp H:120-247

Lineage for d6xqph2 (6xqp H:120-247)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6xqph2: 6xqp H:120-247 [393428]
   Other proteins in same PDB: d6xqpa1, d6xqpb1, d6xqpb2, d6xqpc1, d6xqpd1, d6xqpd2, d6xqpe2, d6xqpg2
   automated match to d3q5ya2
   complexed with 2lj, br, cl, gol, na

Details for d6xqph2

PDB Entry: 6xqp, 2.9 Å

PDB Description: structure of human d462-e4 tcr in complex with human mr1-5-op-ru

PDB Compounds: (H:) trbv29-1

SCOPe Domain Sequences for d6xqph2:

Sequence; same for both SEQRES and ATOM records:

>d6xqph2 b.1.1.0 (H:120-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d6xqph2:

• d6xqph2 first appeared in SCOPe 2.07