![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species) contains an extension to the common fold at the N-terminus |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311422] (13 PDB entries) |
![]() | Domain d6xmjb_: 6xmj B: [393384] Other proteins in same PDB: d6xmjh_, d6xmji_, d6xmjj_, d6xmjk_, d6xmjl_, d6xmjm_, d6xmjn_, d6xmjo1, d6xmjo2, d6xmjp1, d6xmjp2, d6xmjq1, d6xmjq2, d6xmjr1, d6xmjr2, d6xmjs1, d6xmjs2, d6xmjt1, d6xmjt2, d6xmju1, d6xmju2 automated match to d1irub_ |
PDB Entry: 6xmj (more details), 3 Å
SCOPe Domain Sequences for d6xmjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xmjb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]} fslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvhkvep itkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytqsggv rpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedleleda ihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia
Timeline for d6xmjb_:
![]() Domains from other chains: (mouse over for more information) d6xmja_, d6xmjc_, d6xmje_, d6xmjf_, d6xmjg_, d6xmjh_, d6xmji_, d6xmjj_, d6xmjk_, d6xmjl_, d6xmjm_, d6xmjn_, d6xmjo1, d6xmjo2, d6xmjp1, d6xmjp2, d6xmjq1, d6xmjq2, d6xmjr1, d6xmjr2, d6xmjs1, d6xmjs2, d6xmjt1, d6xmjt2, d6xmju1, d6xmju2 |