Lineage for d6xmjb_ (6xmj B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2550561Species Human (Homo sapiens) [TaxId:9606] [311422] (13 PDB entries)
  8. 3093322Domain d6xmjb_: 6xmj B: [393384]
    Other proteins in same PDB: d6xmjh_, d6xmji_, d6xmjj_, d6xmjk_, d6xmjl_, d6xmjm_, d6xmjn_, d6xmjo1, d6xmjo2, d6xmjp1, d6xmjp2, d6xmjq1, d6xmjq2, d6xmjr1, d6xmjr2, d6xmjs1, d6xmjs2, d6xmjt1, d6xmjt2, d6xmju1, d6xmju2
    automated match to d1irub_

Details for d6xmjb_

PDB Entry: 6xmj (more details), 3 Å

PDB Description: human 20s proteasome bound to an engineered 11s (pa26) activator
PDB Compounds: (B:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d6xmjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xmjb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
fslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvhkvep
itkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytqsggv
rpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedleleda
ihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia

SCOPe Domain Coordinates for d6xmjb_:

Click to download the PDB-style file with coordinates for d6xmjb_.
(The format of our PDB-style files is described here.)

Timeline for d6xmjb_:

  • d6xmjb_ is new in SCOPe 2.07-stable