Lineage for d1f5aa1 (1f5a A:365-498)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192602Superfamily d.58.16: Poly(A) polymerase, C-terminal domain [55003] (1 family) (S)
  5. 192603Family d.58.16.1: Poly(A) polymerase, C-terminal domain [55004] (1 protein)
  6. 192604Protein Poly(A) polymerase, C-terminal domain [55005] (2 species)
  7. 192608Species Cow (Bos taurus) [TaxId:9913] [55007] (1 PDB entry)
  8. 192609Domain d1f5aa1: 1f5a A:365-498 [39337]
    Other proteins in same PDB: d1f5aa2

Details for d1f5aa1

PDB Entry: 1f5a (more details), 2.5 Å

PDB Description: crystal structure of mammalian poly(a) polymerase

SCOP Domain Sequences for d1f5aa1:

Sequence, based on SEQRES records: (download)

>d1f5aa1 d.58.16.1 (A:365-498) Poly(A) polymerase, C-terminal domain {Cow (Bos taurus)}
pnffqkykhyivllasaptekqrlewvglveskirilvgsleknefitlahvnpqsfpap
kenpdkeefrtmwviglvfkktensenlsvdltydiqsftdtvyrqainskmfevdmkia
amhvkrkqlhqllp

Sequence, based on observed residues (ATOM records): (download)

>d1f5aa1 d.58.16.1 (A:365-498) Poly(A) polymerase, C-terminal domain {Cow (Bos taurus)}
pnffqkykhyivllasaptekqrlewvglveskirilvgsleknefitlahvnpqsfpak
eefrtmwviglvfkdltydiqsftdtvyrqainskmfevdmkiaamhvkrkqlhqllp

SCOP Domain Coordinates for d1f5aa1:

Click to download the PDB-style file with coordinates for d1f5aa1.
(The format of our PDB-style files is described here.)

Timeline for d1f5aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f5aa2