Lineage for d6xmjt1 (6xmj T:4-226)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311718Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 2311719Family a.24.8.1: Proteasome activator [47217] (3 proteins)
  6. 2311732Protein automated matches [190828] (1 species)
    not a true protein
  7. 2311733Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188131] (7 PDB entries)
  8. 3093298Domain d6xmjt1: 6xmj T:4-226 [393360]
    Other proteins in same PDB: d6xmja_, d6xmjb_, d6xmjc_, d6xmje_, d6xmjf_, d6xmjg_, d6xmjh_, d6xmji_, d6xmjj_, d6xmjk_, d6xmjl_, d6xmjm_, d6xmjn_, d6xmjo2, d6xmjp2, d6xmjq2, d6xmjr2, d6xmjs2, d6xmjt2, d6xmju2
    automated match to d3jrmo_

Details for d6xmjt1

PDB Entry: 6xmj (more details), 3 Å

PDB Description: human 20s proteasome bound to an engineered 11s (pa26) activator
PDB Compounds: (T:) proteasome activator protein PA26

SCOPe Domain Sequences for d6xmjt1:

Sequence, based on SEQRES records: (download)

>d6xmjt1 a.24.8.1 (T:4-226) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgn

Sequence, based on observed residues (ATOM records): (download)

>d6xmjt1 a.24.8.1 (T:4-226) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
tlgspigmyalreylsarstvedkllgggsqspslllelrqidadfmlkvelatthlstm
vravinayllnwkkliqprtgn

SCOPe Domain Coordinates for d6xmjt1:

Click to download the PDB-style file with coordinates for d6xmjt1.
(The format of our PDB-style files is described here.)

Timeline for d6xmjt1:

  • d6xmjt1 is new in SCOPe 2.07-stable