Lineage for d6xmjg_ (6xmj G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2990749Species Human (Homo sapiens) [TaxId:9606] [311422] (15 PDB entries)
  8. 2990813Domain d6xmjg_: 6xmj G: [393354]
    Other proteins in same PDB: d6xmjh_, d6xmji_, d6xmjj_, d6xmjk_, d6xmjl_, d6xmjm_, d6xmjn_, d6xmjo1, d6xmjo2, d6xmjp1, d6xmjp2, d6xmjq1, d6xmjq2, d6xmjr1, d6xmjr2, d6xmjs1, d6xmjs2, d6xmjt1, d6xmjt2, d6xmju1, d6xmju2
    automated match to d1irug_

Details for d6xmjg_

PDB Entry: 6xmj (more details), 3 Å

PDB Description: human 20s proteasome bound to an engineered 11s (pa26) activator
PDB Compounds: (G:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d6xmjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xmjg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
gydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsnkr
lfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhaytly
savrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmkemt
crdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakeslke

SCOPe Domain Coordinates for d6xmjg_:

Click to download the PDB-style file with coordinates for d6xmjg_.
(The format of our PDB-style files is described here.)

Timeline for d6xmjg_: