Lineage for d6xmjk_ (6xmj K:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2550690Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2552556Species Human (Homo sapiens) [TaxId:9606] [311421] (13 PDB entries)
  8. 3093273Domain d6xmjk_: 6xmj K: [393335]
    Other proteins in same PDB: d6xmja_, d6xmjb_, d6xmjc_, d6xmje_, d6xmjf_, d6xmjg_, d6xmji_, d6xmjo1, d6xmjo2, d6xmjp1, d6xmjp2, d6xmjq1, d6xmjq2, d6xmjr1, d6xmjr2, d6xmjs1, d6xmjs2, d6xmjt1, d6xmjt2, d6xmju1, d6xmju2
    automated match to d1iruk_

Details for d6xmjk_

PDB Entry: 6xmj (more details), 3 Å

PDB Description: human 20s proteasome bound to an engineered 11s (pa26) activator
PDB Compounds: (K:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6xmjk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xmjk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Human (Homo sapiens) [TaxId: 9606]}
meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
riidkngihdldnisfpkq

SCOPe Domain Coordinates for d6xmjk_:

Click to download the PDB-style file with coordinates for d6xmjk_.
(The format of our PDB-style files is described here.)

Timeline for d6xmjk_:

  • d6xmjk_ is new in SCOPe 2.07-stable