Lineage for d1hnwj_ (1hnw J:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80561Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 80562Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 80563Protein Ribosomal protein S10 [55001] (1 species)
  7. 80564Species Thermus thermophilus [TaxId:274] [55002] (10 PDB entries)
  8. 80570Domain d1hnwj_: 1hnw J: [39333]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwj_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1hnwj_:

Click to download the PDB-style file with coordinates for d1hnwj_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwj_: