Lineage for d6xkpn1 (6xkp N:3-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757354Domain d6xkpn1: 6xkp N:3-108 [393325]
    Other proteins in same PDB: d6xkpa_, d6xkpb_, d6xkph_, d6xkpl2, d6xkpm_, d6xkpn2
    automated match to d1aqkl1
    complexed with nag, so4

Details for d6xkpn1

PDB Entry: 6xkp (more details), 2.72 Å

PDB Description: crystal structure of sars-cov-2 receptor binding domain in complex with neutralizing antibody cv07-270
PDB Compounds: (N:) CV07-270 Light Chain

SCOPe Domain Sequences for d6xkpn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xkpn1 b.1.1.0 (N:3-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiyevsnrpsgvsn
rfsgsksgntasltisglqaedeadyycssytsssnvvfgggtmltvlg

SCOPe Domain Coordinates for d6xkpn1:

Click to download the PDB-style file with coordinates for d6xkpn1.
(The format of our PDB-style files is described here.)

Timeline for d6xkpn1: