SCOPe 2.02: Domain d1hnzj_: 1hnz J:

Lineage for d1hnzj_ (1hnz J:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family)

5. Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)

6. Protein Ribosomal protein S10 [55001] (2 species)

7. Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
   Uniprot P80375

8. Domain d1hnzj_: 1hnz J: [39332]
   Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
   complexed with hyg, mg, zn

Details for d1hnzj_

PDB Entry: 1hnz, 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d1hnzj_:

Sequence; same for both SEQRES and ATOM records:

>d1hnzj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

Timeline for d1hnzj_:

• d1hnzj_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnzj_ appears in SCOPe 2.01
  
• d1hnzj_ appears in SCOPe 2.03
  
• d1hnzj_ appears in the current release, SCOPe 2.08