Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) automatically mapped to Pfam PF00338 |
Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
Protein Ribosomal protein S10 [55001] (2 species) |
Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries) Uniprot P80375 |
Domain d1hr0j_: 1hr0 J: [39331] Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_ complexed with mg, zn |
PDB Entry: 1hr0 (more details), 3.2 Å
SCOPe Domain Sequences for d1hr0j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]} kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d1hr0j_: