Lineage for d6xkrp_ (6xkr P:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741861Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)
  7. 2741862Species Human (Homo sapiens) [TaxId:9606] [256383] (17 PDB entries)
  8. 2741877Domain d6xkrp_: 6xkr P: [393304]
    Other proteins in same PDB: d6xkrh_, d6xkrl1, d6xkrl2
    automated match to d3rrqa_
    complexed with gol

Details for d6xkrp_

PDB Entry: 6xkr (more details), 2.59 Å

PDB Description: structure of sasanlimab fab in complex with pd-1
PDB Compounds: (P:) Programmed cell death protein 1

SCOPe Domain Sequences for d6xkrp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xkrp_ b.1.1.1 (P:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
wnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgq
dcrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrv

SCOPe Domain Coordinates for d6xkrp_:

Click to download the PDB-style file with coordinates for d6xkrp_.
(The format of our PDB-style files is described here.)

Timeline for d6xkrp_: