Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [256383] (17 PDB entries) |
Domain d6xkrp_: 6xkr P: [393304] Other proteins in same PDB: d6xkrh_, d6xkrl1, d6xkrl2 automated match to d3rrqa_ complexed with gol |
PDB Entry: 6xkr (more details), 2.59 Å
SCOPe Domain Sequences for d6xkrp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xkrp_ b.1.1.1 (P:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]} wnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgq dcrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrv
Timeline for d6xkrp_: