SCOPe 2.08: Domain d6xbzi1: 6xbz I:1-161

Lineage for d6xbzi1 (6xbz I:1-161)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)

8. Domain d6xbzi1: 6xbz I:1-161 [393293]
   Other proteins in same PDB: d6xbzj_
   automated match to d1kxua1
   complexed with ags, mg

Details for d6xbzi1

PDB Entry: 6xbz, 2.8 Å

PDB Description: structure of the human cdk-activating kinase

PDB Compounds: (I:) Cyclin-H

SCOPe Domain Sequences for d6xbzi1:

Sequence, based on SEQRES records:

>d6xbzi1 a.74.1.1 (I:1-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myhnssqkrhwtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyy
ekrllefcsvfkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnv
sspqfvgnlresplgqekaleqileyellliqqlnfhlivh

Sequence, based on observed residues (ATOM records):

>d6xbzi1 a.74.1.1 (I:1-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myhnssqkrhwtfsseeqlarlradanrkfrckavangpndpvflepheemtlckyyekr
llefcsvfkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnvssp
qfvgnlresplgqekaleqileyellliqqlnfhlivh

Timeline for d6xbzi1:

• d6xbzi1 first appeared in SCOPe 2.07