SCOPe 2.08: Domain d6x4tf2: 6x4t F:107-212

Lineage for d6x4tf2 (6x4t F:107-212)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d6x4tf2: 6x4t F:107-212 [393291]
Other proteins in same PDB: d6x4tb_, d6x4td_, d6x4te1, d6x4tf1, d6x4tg_, d6x4tn_
automated match to d1dn0a2
complexed with gol, nag

Details for d6x4tf2

PDB Entry: 6x4t (more details), 3.15 Å

PDB Description: crystal structure of icos-l in complex with prezalumab and vnar domain

PDB Compounds: (F:) Prezalumab Fab Light chain

SCOPe Domain Sequences for d6x4tf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x4tf2 b.1.1.2 (F:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d6x4tf2:

Click to download the PDB-style file with coordinates for d6x4tf2.
(The format of our PDB-style files is described here.)

Timeline for d6x4tf2: