Lineage for d6x4tf1 (6x4t F:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758132Domain d6x4tf1: 6x4t F:1-106 [393290]
    Other proteins in same PDB: d6x4tb_, d6x4td_, d6x4te2, d6x4tf2, d6x4tg_, d6x4tn_
    automated match to d1dn0a1
    complexed with gol, nag

Details for d6x4tf1

PDB Entry: 6x4t (more details), 3.15 Å

PDB Description: crystal structure of icos-l in complex with prezalumab and vnar domain
PDB Compounds: (F:) Prezalumab Fab Light chain

SCOPe Domain Sequences for d6x4tf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x4tf1 b.1.1.0 (F:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqgisnwlawyqqkpekapksliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqydsyprtfgqgtkvei

SCOPe Domain Coordinates for d6x4tf1:

Click to download the PDB-style file with coordinates for d6x4tf1.
(The format of our PDB-style files is described here.)

Timeline for d6x4tf1: