Lineage for d1fjfj_ (1fjf J:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32892Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 32893Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 32894Protein Ribosomal protein S10 [55001] (1 species)
  7. 32895Species Thermus thermophilus [TaxId:274] [55002] (6 PDB entries)
  8. 32896Domain d1fjfj_: 1fjf J: [39329]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfj_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1fjfj_:

Click to download the PDB-style file with coordinates for d1fjfj_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfj_: