Lineage for d1qjha_ (1qjh A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560503Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 2560504Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 2560505Protein Ribosomal protein S6 [54997] (4 species)
  7. 2560535Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 2560590Domain d1qjha_: 1qjh A: [39326]
    mutant engineered for aggregation
    complexed with mg

Details for d1qjha_

PDB Entry: 1qjh (more details), 2.2 Å

PDB Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
PDB Compounds: (A:) ribosomal protein s6

SCOPe Domain Sequences for d1qjha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjha_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglmvlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvks

SCOPe Domain Coordinates for d1qjha_:

Click to download the PDB-style file with coordinates for d1qjha_.
(The format of our PDB-style files is described here.)

Timeline for d1qjha_: