Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) |
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
Protein Ribosomal protein S6 [54997] (4 species) |
Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries) Uniprot P23370 |
Domain d1qjha_: 1qjh A: [39326] mutant engineered for aggregation complexed with mg |
PDB Entry: 1qjh (more details), 2.2 Å
SCOPe Domain Sequences for d1qjha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qjha_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]} mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglmvlaypiakdpqgyf lwyqvempedrvndlarelrirdnvrrvmvvks
Timeline for d1qjha_: