SCOP 1.71: Domain d1qjha_: 1qjh A:

Lineage for d1qjha_ (1qjh A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (24 PDB entries)

8. Domain d1qjha_: 1qjh A: [39326]
   mutant engineered for aggregation

Details for d1qjha_

PDB Entry: 1qjh, 2.2 Å

PDB Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.

SCOP Domain Sequences for d1qjha_:

Sequence; same for both SEQRES and ATOM records:

>d1qjha_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglmvlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvks

Timeline for d1qjha_:

• d1qjha_ first appeared (with stable ids) in SCOP 1.55
  
• d1qjha_ appears in SCOP 1.69
  
• d1qjha_ appears in SCOP 1.73
  
• d1qjha_ appears in the current release, SCOPe 2.08