Lineage for d1cqmb_ (1cqm B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) 
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) Protein Ribosomal protein S6 [54997] (4 species) 
Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
Uniprot P23370
Domain d1cqmb_: 1cqm B: [39322]
mutant engineered for aggregation
Details for d1cqmb_
PDB Entry: 1cqm (more details), 1.65 Å
PDB Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
PDB Compounds: (B:) ribosomal protein s6SCOPe Domain Sequences for d1cqmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqmb_ d.58.14.1 (B:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
SCOPe Domain Coordinates for d1cqmb_:
Click to download the PDB-style file with coordinates for d1cqmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cqmb_:
- d1cqmb_ first appeared (with stable ids) in SCOP 1.55
- d1cqmb_ appears in SCOPe 2.07
View in 3D
