Lineage for d1hnxf_ (1hnx F:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725083Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 725084Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 725085Protein Ribosomal protein S6 [54997] (2 species)
  7. 725088Species Thermus thermophilus [TaxId:274] [54998] (42 PDB entries)
  8. 725105Domain d1hnxf_: 1hnx F: [39320]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
    complexed with mg, pcy, zn

Details for d1hnxf_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
PDB Compounds: (F:) 30S ribosomal protein S6

SCOP Domain Sequences for d1hnxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1hnxf_:

Click to download the PDB-style file with coordinates for d1hnxf_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxf_: