Lineage for d1hnwf_ (1hnw F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653465Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1653466Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1653467Protein Ribosomal protein S6 [54997] (4 species)
  7. 1653497Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1653523Domain d1hnwf_: 1hnw F: [39319]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
    complexed with mg, tac, zn

Details for d1hnwf_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1hnwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d1hnwf_:

Click to download the PDB-style file with coordinates for d1hnwf_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwf_: