Lineage for d1risa_ (1ris A:)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) 
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) Protein Ribosomal protein S6 [54997] (4 species) 
Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
Uniprot P23370
Domain d1risa_: 1ris A: [39314]
Details for d1risa_
PDB Entry: 1ris (more details), 2 Å
PDB Description: crystal structure of the ribosomal protein s6 from thermus thermophilus
PDB Compounds: (A:) ribosomal protein s6SCOPe Domain Sequences for d1risa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1risa_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepf
SCOPe Domain Coordinates for d1risa_:
Click to download the PDB-style file with coordinates for d1risa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1risa_:
- d1risa_ first appeared (with stable ids) in SCOP 1.55, called d1ris__
- d1risa_ appears in SCOP 1.75
- d1risa_ appears in SCOPe 2.02
- d1risa_ appears in the current release, SCOPe 2.08
View in 3D