SCOP 1.69: Domain d1f60b_: 1f60 B:

Lineage for d1f60b_ (1f60 B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.12: eEF-1beta-like [54984] (1 family)

5. Family d.58.12.1: eEF-1beta-like [54985] (2 proteins)

6. Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (4 PDB entries)

8. Domain d1f60b_: 1f60 B: [39307]
   Other proteins in same PDB: d1f60a1, d1f60a2, d1f60a3

Details for d1f60b_

PDB Entry: 1f60, 1.67 Å

PDB Description: crystal structure of the yeast elongation factor complex eef1a:eef1ba

SCOP Domain Sequences for d1f60b_:

Sequence; same for both SEQRES and ATOM records:

>d1f60b_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae)}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqkl

Timeline for d1f60b_:

• d1f60b_ first appeared (with stable ids) in SCOP 1.55
  
• d1f60b_ appears in SCOP 1.67
  
• d1f60b_ appears in SCOP 1.71
  
• d1f60b_ appears in the current release, SCOPe 2.08