Lineage for d1f60b_ (1f60 B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80517Superfamily d.58.12: eEF-1beta-like [54984] (1 family) (S)
  5. 80518Family d.58.12.1: eEF-1beta-like [54985] (2 proteins)
  6. 80522Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)
  7. 80523Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (4 PDB entries)
  8. 80524Domain d1f60b_: 1f60 B: [39307]
    Other proteins in same PDB: d1f60a1, d1f60a2, d1f60a3

Details for d1f60b_

PDB Entry: 1f60 (more details), 1.67 Å

PDB Description: crystal structure of the yeast elongation factor complex eef1a:eef1ba

SCOP Domain Sequences for d1f60b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f60b_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae)}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqkl

SCOP Domain Coordinates for d1f60b_:

Click to download the PDB-style file with coordinates for d1f60b_.
(The format of our PDB-style files is described here.)

Timeline for d1f60b_: