SCOP 1.73: Domain d1efga4: 1efg A:600-689

Lineage for d1efga4 (1efg A:600-689)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
   domain III structure is lacking some of the superfamily characters and is often disordered in crystals

6. Protein Elongation factor G (EF-G) [54982] (2 species)
   domain III is seen in 1FNM but disordered in the most of other PDB entries

7. Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)

8. Domain d1efga4: 1efg A:600-689 [39305]
   Other proteins in same PDB: d1efga1, d1efga2, d1efga3
   complexed with gdp

Details for d1efga4

PDB Entry: 1efg, 2.7 Å

PDB Description: the crystal structure of elongation factor g complexed with gdp, at 2.7 angstroms resolution

PDB Compounds: (A:) Elongation factor G

SCOP Domain Sequences for d1efga4:

Sequence; same for both SEQRES and ATOM records:

>d1efga4 d.58.11.1 (A:600-689) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik

Timeline for d1efga4:

• d1efga4 first appeared (with stable ids) in SCOP 1.55
  
• d1efga4 appears in SCOP 1.71
  
• d1efga4 appears in SCOP 1.75
  
• d1efga4 appears in the current release, SCOPe 2.08