Lineage for d1elo_4 (1elo 600-689)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257706Superfamily d.58.11: EF-G/eEF-2 domains III and V [54980] (1 family) (S)
  5. 257707Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
  6. 257716Protein Elongation factor G (EF-G) [54982] (1 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 257717Species Thermus thermophilus [TaxId:274] [54983] (5 PDB entries)
  8. 257722Domain d1elo_4: 1elo 600-689 [39304]
    Other proteins in same PDB: d1elo_1, d1elo_2, d1elo_3

Details for d1elo_4

PDB Entry: 1elo (more details), 2.85 Å

PDB Description: elongation factor g without nucleotide

SCOP Domain Sequences for d1elo_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elo_4 d.58.11.1 (600-689) Elongation factor G (EF-G) {Thermus thermophilus}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik

SCOP Domain Coordinates for d1elo_4:

Click to download the PDB-style file with coordinates for d1elo_4.
(The format of our PDB-style files is described here.)

Timeline for d1elo_4: