SCOP 1.63: Domain d1elo_4: 1elo 600-689

Lineage for d1elo_4 (1elo 600-689)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G/eEF-2 domains III and V [54980] (1 family)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)

6. Protein Elongation factor G (EF-G) [54982] (1 species)
   domain III is seen in 1FNM but disordered in the most of other PDB entries

7. Species Thermus thermophilus [TaxId:274] [54983] (5 PDB entries)

8. Domain d1elo_4: 1elo 600-689 [39304]
   Other proteins in same PDB: d1elo_1, d1elo_2, d1elo_3

Details for d1elo_4

PDB Entry: 1elo, 2.85 Å

PDB Description: elongation factor g without nucleotide

SCOP Domain Sequences for d1elo_4:

Sequence; same for both SEQRES and ATOM records:

>d1elo_4 d.58.11.1 (600-689) Elongation factor G (EF-G) {Thermus thermophilus}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik

Timeline for d1elo_4:

• d1elo_4 first appeared (with stable ids) in SCOP 1.55
  
• d1elo_4 appears in SCOP 1.61
  
• d1elo_4 appears in SCOP 1.65
  
• d1elo_4 appears in the current release, SCOPe 2.08, called d1eloa4